Loading...
Statistics
Advertisement

Welcome | seeBucharest
www.seebucharest.com/
A website about Bucharest, the capital city of Romania. See Bucharest believe that pictures speak volumes. Let the images portray Bucharest and discover the ...

Seebucharest.com

Advertisement
Conversion Technology Metas Server
Seebucharest.com is hosted in United Kingdom . Seebucharest.com doesn't use HTTPS protocol. Number of used technologies: 4. First technologies: Carousel, CSS, Html, Number of used javascripts: 1. First javascripts: Application.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: Apache.

Technologies in use by Seebucharest.com

Technology

Number of occurences: 4
  • Carousel
  • CSS
  • Html
  • Javascript

Advertisement

Javascripts

Number of occurences: 1
  • application.js

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Apache

Powered by

  • PHP/5.3.28

Social

Number of occurences: 1
  • Facebook Box

Google Analytics ID

  • UA-43710669-1

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Seebucharest.com

Missing HTTPS protocol.

    Meta - Seebucharest.com

    Number of occurences: 6
    • Name:
      Content: junkystu
    • Name: keywords
      Content: see, bucharest, museums, architecture, visit, bucuresti, seebucharest, hotels, accommodation, stay, art, parliament palace, village museum, attractions, restaurants, travel, tourism, tourist, information, romanian, capital, city, Romania
    • Name: description
      Content: A website about Bucharest, the capital city of Romania. See Bucharest believe that pictures speak volumes. Let the images portray Bucharest and discover the culture, architecture, food, and even learn a few basic expressions in Romanian.
    • Name: twitter:title
      Content: Welcome
    • Name: twitter:image
      Content: /img/site/bg.jpg
    • Name: viewport
      Content: initial-scale=1.0,width=device-width,user-scalable=no

    Server / Hosting

    • IP: 91.208.99.12
    • Latitude: 51.50
    • Longitude: -0.12
    • Country: United Kingdom

    Rname

    • ns1.tsohost.co.uk
    • ns2.tsohost.co.uk
    • ns3.tsohost.co.uk
    • mail3.eqx.gridhost.co.uk

    Target

    • support.tsohost.co.uk

    HTTP Header Response

    HTTP/1.1 200 OK Date: Thu, 28 Apr 2016 23:01:28 GMT Server: Apache X-Powered-By: PHP/5.3.28 Connection: close Content-Type: text/html Set-Cookie: DYNSRV=lin191; path=/

    DNS

    host: seebucharest.com
    1. class: IN
    2. ttl: 86400
    3. type: A
    4. ip: 91.208.99.12
    host: seebucharest.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns1.tsohost.co.uk
    host: seebucharest.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns2.tsohost.co.uk
    host: seebucharest.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns3.tsohost.co.uk
    host: seebucharest.com
    1. class: IN
    2. ttl: 86400
    3. type: SOA
    4. mname: ns1.tsohost.co.uk
    5. rname: support.tsohost.co.uk
    6. serial: 1379509370
    7. refresh: 10800
    8. retry: 3600
    9. expire: 604800
    10. minimum-ttl: 3600
    host: seebucharest.com
    1. class: IN
    2. ttl: 86400
    3. type: MX
    4. pri: 0
    5. target: mail3.eqx.gridhost.co.uk

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.eebucharest.com, www.seeebucharest.com, www.eeebucharest.com, www.sweebucharest.com, www.weebucharest.com, www.sdeebucharest.com, www.deebucharest.com, www.sxeebucharest.com, www.xeebucharest.com, www.sfeebucharest.com, www.feebucharest.com, www.sgeebucharest.com, www.geebucharest.com, www.steebucharest.com, www.teebucharest.com, www.sebucharest.com, www.sxebucharest.com, www.sesebucharest.com, www.ssebucharest.com, www.sewebucharest.com, www.swebucharest.com, www.serebucharest.com, www.srebucharest.com, www.sefebucharest.com, www.sfebucharest.com, www.sevebucharest.com, www.svebucharest.com, www.secebucharest.com, www.scebucharest.com, www.seqebucharest.com, www.sqebucharest.com, www.seaebucharest.com, www.saebucharest.com, www.seyebucharest.com, www.syebucharest.com, www.sebucharest.com, www.seexbucharest.com, www.seesbucharest.com, www.sesbucharest.com, www.seewbucharest.com, www.sewbucharest.com, www.seerbucharest.com, www.serbucharest.com, www.seefbucharest.com, www.sefbucharest.com, www.seevbucharest.com, www.sevbucharest.com, www.seecbucharest.com, www.secbucharest.com, www.seeqbucharest.com, www.seqbucharest.com, www.seeabucharest.com, www.seabucharest.com, www.seeybucharest.com, www.seybucharest.com, www.seeucharest.com, www.seebqucharest.com, www.seequcharest.com, www.seebwucharest.com, www.seewucharest.com, www.seebzucharest.com, www.seezucharest.com, www.seebxucharest.com, www.seexucharest.com, www.seebucharest.com, www.seeucharest.com, www.seebsucharest.com, www.seesucharest.com, www.seebyucharest.com, www.seeyucharest.com, www.seebeucharest.com, www.seeeucharest.com, www.seebducharest.com, www.seeducharest.com, www.seebcucharest.com, www.seecucharest.com, www.seebcharest.com, www.seebuwcharest.com, www.seebwcharest.com, www.seebuecharest.com, www.seebecharest.com, www.seebuscharest.com, www.seebscharest.com, www.seebuacharest.com, www.seebacharest.com, www.seebuharest.com, www.seebucdharest.com, www.seebudharest.com, www.seebucrharest.com, www.seeburharest.com, www.seebuctharest.com, www.seebutharest.com, www.seebucvharest.com, www.seebuvharest.com, www.seebucfharest.com, www.seebufharest.com, www.seebucgharest.com, www.seebugharest.com, www.seebuchharest.com, www.seebuhharest.com, www.seebucnharest.com, www.seebunharest.com, www.seebucmharest.com, www.seebumharest.com, www.seebucjharest.com, www.seebujharest.com, www.seebucarest.com, www.seebuchearest.com, www.seebucearest.com, www.seebuchdarest.com, www.seebucdarest.com, www.seebuchcarest.com, www.seebuccarest.com, www.seebuchuarest.com, www.seebucuarest.com, www.seebuchjarest.com, www.seebucjarest.com, www.seebucharest.com, www.seebucarest.com, www.seebuchbarest.com, www.seebucbarest.com, www.seebuchgarest.com, www.seebucgarest.com, www.seebuchrest.com, www.seebuchaorest.com, www.seebuchorest.com, www.seebuchaprest.com, www.seebuchprest.com, www.seebucha9rest.com, www.seebuch9rest.com, www.seebucharest.com, www.seebuchrest.com, www.seebuchairest.com, www.seebuchirest.com, www.seebuchaurest.com, www.seebuchurest.com, www.seebuchaest.com, www.seebuchariest.com, www.seebuchaiest.com, www.seebucharoest.com, www.seebuchaoest.com, www.seebucharlest.com, www.seebuchalest.com, www.seebucharlest.com, www.seebuchalest.com, www.seebuchar.est.com, www.seebucha.est.com, www.seebucharst.com, www.seebucharexst.com, www.seebucharxst.com, www.seebucharesst.com, www.seebucharsst.com, www.seebucharewst.com, www.seebucharwst.com, www.seebucharerst.com, www.seebucharrst.com, www.seebucharefst.com, www.seebucharfst.com, www.seebucharevst.com, www.seebucharvst.com, www.seebucharecst.com, www.seebucharcst.com, www.seebuchareqst.com, www.seebucharqst.com, www.seebuchareast.com, www.seebucharast.com, www.seebuchareyst.com, www.seebucharyst.com,

    Other websites we recently analyzed

    1. SVRUJI APPAREL
      Virgin Islands, British - 5.100.152.26
      Server software: Apache Phusion_Passenger/4.0.10 mod_bwlimited/1.4 mod_fcgid/2.3.9
      Technology: BootstrapCDN, Maxcdn, Font Awesome, Html
      Number of Javascript: 2
      Number of meta tags: 3
    2. tigertequila.com at Directnic
      Cayman Islands - 74.117.221.21
      Server software: nginx/1.5.0
      Technology: Html, Javascript
      Number of Javascript: 1
    3. Nettikasino Suomi • Rahapelit internetissä • Pelimerkki.com
      Ota suunnaksi suomalainen nettikasino Pelimerkin sivuilta. Esittelemme ne parhaat pelisivustot, joissa meidän suomalaisten kannattaa pelata rahasta.
      Netherlands - 188.121.39.233
      G Analytics ID: UA-52667467-1
      Server software:
      Technology: CSS, Html, Javascript, jQuery, Php, Pingback, Clicky Web Analytics, Google Analytics, Wordpress
      Number of Javascript: 5
      Number of meta tags: 5
    4. 2hover.net
      Switzerland - 141.8.225.72
      Server software: Apache
      Technology: CloudFront, Google Adsense, CSS, Html, Javascript, Php
      Number of Javascript: 4
      Number of meta tags: 2
    5. 2015 Wedding Dress Fashion Trend Inexpensive Prom Dresses
      2015 fashion wedding dresses under 100, prom dresses, evening dresses collection, the most excellent designers and professional tailors guarantee best custom made dresses.
      Los Angeles (United States) - 155.94.236.167
      Server software: Apache/2.2.15
      Technology: CSS, Html, Javascript, jQuery Validate, Wordpress
      Number of Javascript: 8
      Number of meta tags: 6
    6. Defiance College Apparel, Shop Defiance Gear, Defiance Yellow Jackets Merchandise, Store, Bookstore, Gifts, Tees, Caps, Jerseys
      Defiance College Apparel and Defiance Yellow Jackets Gear from the tremendous Defiance Yellow Jackets fan store. Our Defiance Apparel and merchandise shop will help fans prepare for football, basketball, baseball, and lacrosse season.
      Coppell (United States) - 68.91.160.27
      G Analytics ID: UA-44540413-5
      Server software: Microsoft-IIS/8.5
      Technology: BootstrapCDN, Maxcdn, AdRoll, CSS, Font Awesome, Html, Javascript, Google Analytics
      Number of Javascript: 2
      Number of meta tags: 3
    7. jeepbrasil.com.br
      Porto Alegre (Brazil) - 186.237.28.4
      Server software: Microsoft-IIS/6.0
      Technology: Html
      Number of meta tags: 1
    8. PLEASANTVIEWFAMILYHEALTHCARE.COM
      Jacksonville (United States) - 205.178.189.131
      Server software: Sun-ONE-Web-Server/6.1
      Technology: Html
      Number of meta tags: 1
    9. 1ï¼…ER TATTOO
      Japan - 210.188.245.26
      Server software: Apache
      Technology: Html, Html5
      Number of meta tags: 1
    10. Medien und Praxishilfen
      Germany - 80.86.88.175
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html, Javascript
      Number of Javascript: 4
      Number of meta tags: 2

    Check Other Websites